PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010814-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 174aa    MW: 18976.4 Da    PI: 10.5066
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010814-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.87e-15106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
    NNU_010814-RA 106 PWTEEEHRTFLAGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 150
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.15599155IPR017930Myb domain
SuperFamilySSF466892.66E-18100156IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-19102154IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-12103149IPR009057Homeodomain-like
SMARTSM007172.2E-11103153IPR001005SANT/Myb domain
CDDcd001671.24E-10106151No hitNo description
PfamPF002493.5E-12106150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT YRGSAAAAVG GLRLFGVQLD LLSSSPSLSM KKSFSMDCLP  60
SASSSSASSS SSSSQVVTDE NSDKAPNGYL SDGLVARTQE RKKGVPWTEE EHRTFLAGLE  120
KLGKGDWRGI SRNFVTTRTP TQVASHAQKY FLRQTSLNKK KRRSSLFDMV YPPF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158162KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262182.11e-122PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A061GMU93e-87A0A061GMU9_THECC; Myb-like transcription factor family protein, putative
STRINGVIT_11s0016g02410.t019e-86(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-56MYB_related family protein